Protein Info for Psest_2874 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyltransferases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 138 to 159 (22 residues), see Phobius details amino acids 169 to 187 (19 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 224 to 245 (22 residues), see Phobius details amino acids 257 to 275 (19 residues), see Phobius details amino acids 284 to 307 (24 residues), see Phobius details amino acids 317 to 335 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 334 (330 residues), 76.7 bits, see alignment E=8.8e-26

Best Hits

KEGG orthology group: None (inferred from 83% identity to psa:PST_1506)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKU0 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Psest_2874 Predicted acyltransferases (Pseudomonas stutzeri RCH2)
MSRLLGLDALRGVAALCVAYSHLIAKMKRDGHFDEMTGLLFLLSKAVLDVGKTSVLVLFA
LSGYFVVAALYKSRGRYERPIAAFVYQRFFRLFPLYWLSLFLGVMFPWDDPAKVFSPAVI
AINATMLQGFVLVENVIGLYWTLQIELTFYVLCILLFALRLGGSAKRDLLFLLVQYLFTL
SLAFLRYKLEIKLPVALPLMLSVCFLGALWKATDNGRATDTGHYARIAVGLFYLFLLPIC
VLAYSRDTGFGESWYRYFVSYGVGVALFLGATRISGNRLRWLAPLGGVGYIIFLSHPSVF
AIVELLGFGAGDLAVPGPLYIAAMLILLTLFGFFVKRTLADPIQRYGDAVVSRRGRRRGE
GIVLPVRQDA