Protein Info for Psest_2869 in Pseudomonas stutzeri RCH2

Annotation: Predicted exonuclease of the beta-lactamase fold involved in RNA processing

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF00753: Lactamase_B" amino acids 14 to 209 (196 residues), 51.5 bits, see alignment E=3.3e-17 PF16661: Lactamase_B_6" amino acids 23 to 172 (150 residues), 29.8 bits, see alignment E=9.2e-11 PF12706: Lactamase_B_2" amino acids 27 to 227 (201 residues), 33.5 bits, see alignment E=8.6e-12 PF10996: Beta-Casp" amino acids 255 to 385 (131 residues), 111.8 bits, see alignment E=7.5e-36 PF07521: RMMBL" amino acids 399 to 461 (63 residues), 67.4 bits, see alignment E=2.3e-22

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 95% identity to psa:PST_1511)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKT5 at UniProt or InterPro

Protein Sequence (469 amino acids)

>Psest_2869 Predicted exonuclease of the beta-lactamase fold involved in RNA processing (Pseudomonas stutzeri RCH2)
MALLSFLGAIQQVTGSCYLIETHDGIRVLLECGMHQGRREEESDNRAAFAFDPTTLDAVV
LSHAHIDHSGLLPRLVALGYRGPVHCTDATAELLELMLLDSAQIQEKDAEWENKWRARIG
KPMIQPLYTRVDAERMLSQREPHAYGETFEVAQGVVVTFHDAGHILGSSIVQMDVSDHGR
TRRLVFSGDLGNACSPLMHPPTVLKEADVVLMESTYGDRDHRSHEDTVEELAGILQQAHR
DGGNVLMPSFAVGRTQDLIYYLGRFYREGRLPQQAVFLDSPMAIGANAIYSHYKDQLDLN
GIDAALSGTSGKLYAERWLPILKPTPTPEESMAINRFKSGVIIIAGSGMCTGGRILHHFK
HNLWREECHLVIPGFQARGTLGRAIVDGAGSVKLLHQRIAVNAKIHTLGGFSAHAGQSQL
IDWVSNFENRPELYLVHGELEKMQVLQQAIRDRLNWEARIPEPGDRIAL