Protein Info for Psest_2865 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 10 to 29 (20 residues), see Phobius details amino acids 35 to 55 (21 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 95 to 119 (25 residues), see Phobius details amino acids 126 to 144 (19 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 242 to 263 (22 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details PF00892: EamA" amino acids 7 to 143 (137 residues), 63.8 bits, see alignment E=1e-21 amino acids 153 to 283 (131 residues), 70.9 bits, see alignment E=6.7e-24

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_1515)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPX0 at UniProt or InterPro

Protein Sequence (303 amino acids)

>Psest_2865 Predicted permease, DMT superfamily (Pseudomonas stutzeri RCH2)
MRSQALRADFLMLITAMIWGTAFVAQRIGMDNIGPFLFTGLRFALGALALLPLVIYQGRT
KARHEPFLQRGLLLGGLSMGLALTLGINLQQVGLLFTSVTNSGFITGLYVIVVPLLGLAI
GHKTGFGTWLGAFLAVAGMAMLSIGEDFTVASGDWIQLAGAFVWGVHVLLVSFFVSRHDA
IRLAFLQFATCAVVSLLLALVFEEINPSSIWLAGPALIYGGLFAVAVGYTLQVVAQKHAI
ASHAAIILSLEAVFAAIAGALFLEESLTLRGYMGCVLMFIGMLAAQLWPRKPEVSTTSAA
VKV