Protein Info for PGA1_c28510 in Phaeobacter inhibens DSM 17395

Annotation: putative transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 276 transmembrane" amino acids 122 to 140 (19 residues), see Phobius details PF13276: HTH_21" amino acids 33 to 89 (57 residues), 41.2 bits, see alignment E=2.4e-14 PF00665: rve" amino acids 112 to 205 (94 residues), 80.4 bits, see alignment E=1.6e-26 PF13683: rve_3" amino acids 196 to 261 (66 residues), 55.4 bits, see alignment E=6e-19

Best Hits

KEGG orthology group: K07497, putative transposase (inferred from 71% identity to rle:pRL70168)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZZ2 at UniProt or InterPro

Protein Sequence (276 amino acids)

>PGA1_c28510 putative transposase (Phaeobacter inhibens DSM 17395)
MTNRDHKLSLARQADLLGISRGSLYYEPRPACEDDLRLMRRIDELHMDYPFAGSRMMKGL
LRQEGFTAGRLHVASCMKRMGIQALYRRPNTSKPAPGHKVSAYLLRTFAVIRPNQVWAMD
ITYIPMARGFVYLVAMLDWFSRKVLAWRLSTPLETGPCIEALKDARRHHGKPEIMNTDQG
SPFTSIDFIKTLKDAGIQISMEDKGAWRDNVFVERLWRTIKYEEIYLHAYESVSAARESL
CRYLAFYNSMSPHSSLDGQTPDQAYLKPLRPIPVAA