Protein Info for Psest_2862 in Pseudomonas stutzeri RCH2

Annotation: Flavodoxin reductases (ferredoxin-NADPH reductases) family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00970: FAD_binding_6" amino acids 15 to 98 (84 residues), 34.7 bits, see alignment E=1.9e-12 PF00175: NAD_binding_1" amino acids 112 to 228 (117 residues), 36.2 bits, see alignment E=8.2e-13

Best Hits

Swiss-Prot: 88% identical to FENR_AZOVI: Ferredoxin--NADP reductase (fpr) from Azotobacter vinelandii

KEGG orthology group: K00528, ferredoxin--NADP+ reductase [EC: 1.18.1.2] (inferred from 96% identity to psa:PST_1518)

Predicted SEED Role

"Ferredoxin--NADP(+) reductase (EC 1.18.1.2)" in subsystem Biogenesis of cytochrome c oxidases (EC 1.18.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.18.1.2

Use Curated BLAST to search for 1.18.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMY9 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Psest_2862 Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 (Pseudomonas stutzeri RCH2)
MSNLNVERVLSVHHWNDTLFSFKTTRNAGLRFENGQFVMIGLEVEGRPLMRAYSIASPNY
EEYLEFFSIKVQNGPLTSRLQHLQEGDQIMVSRKPTGTLVLDDLLPGKHLYLLSTGTGLA
PFMSVIQDPETYERFEKVVLVHGVRYVNEVAYREFITEHLPQNEFFGEAVKEKLIYYPTV
TREAFENQGRLTELMRSGKLFSDIGLPPINPQDDRAMICGSPSMLDETSQVLNSFGLSVS
PRMGDPGHYLIERAFVEK