Protein Info for Psest_2861 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 161 PF17775: YchJ_M-like" amino acids 34 to 132 (99 residues), 93.6 bits, see alignment E=1.1e-30 PF02810: SEC-C" amino acids 141 to 158 (18 residues), 40.2 bits, see alignment (E = 2.5e-14)

Best Hits

Swiss-Prot: 78% identical to Y1155_PSEP1: UPF0225 protein Pput_1155 (Pput_1155) from Pseudomonas putida (strain ATCC 700007 / DSM 6899 / BCRC 17059 / F1)

KEGG orthology group: K09858, SEC-C motif domain protein (inferred from 83% identity to psa:PST_1519)

Predicted SEED Role

"UPF0225 protein YchJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPQ7 at UniProt or InterPro

Protein Sequence (161 amino acids)

>Psest_2861 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MSDQQQLDSNCPCGSGNAFNQCCGHYHAGTPAPSAELLMRSRYSAYVLGLVDYLQATTLP
AQQAALDLEGIRRWSLDSTWLGLEVEDSVVLGGKPEHALVTFTARWHDQDGEHAHQERSA
FVQCNGKWYFIDPTVPLKAGRNDPCPCGSGAKFKKCCAAYV