Protein Info for Psest_2859 in Pseudomonas stutzeri RCH2

Annotation: Outer membrane protein and related peptidoglycan-associated (lipo)proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00691: OmpA" amino acids 107 to 202 (96 residues), 79.6 bits, see alignment E=9.9e-27

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_1521)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKS7 at UniProt or InterPro

Protein Sequence (212 amino acids)

>Psest_2859 Outer membrane protein and related peptidoglycan-associated (lipo)proteins (Pseudomonas stutzeri RCH2)
MSTLRTAVPVIVMTTFLAGCAGVQKQDWPTCAAVGGVTGAALGAIESSSYAGWGALIGGG
VAAAYCWANGMEEETVAVVETVEPMPQSQPEPEPASEPVRVELDVKFDFDRDVVKQDSYG
DIQNLADFMKEYRQTTTVLEGHTDSVGTDAYNQRLSERRAKAVREVLVNQYGVEGSRVNS
VGYGESRPVADNATEEGRAINRRVEAEVEARP