Protein Info for HP15_2744 in Marinobacter adhaerens HP15

Annotation: NnrU

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 40 to 59 (20 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 113 to 138 (26 residues), see Phobius details amino acids 159 to 181 (23 residues), see Phobius details PF07298: NnrU" amino acids 4 to 188 (185 residues), 198.4 bits, see alignment E=4.6e-63

Best Hits

KEGG orthology group: None (inferred from 54% identity to alv:Alvin_3109)

Predicted SEED Role

"NnrU family protein, required for expression of nitric oxide and nitrite reductases (Nir and Nor)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKN2 at UniProt or InterPro

Protein Sequence (189 amino acids)

>HP15_2744 NnrU (Marinobacter adhaerens HP15)
MTTLIVGLILFLGVHSLSIINEPLRNRLNASMGEGAFKGLYSVVSLVGLVLIVWGYGAAR
MDPTLIYMPPAWLKHVAFLLLVPVFPLLFATYLPGKIKAKLKHPMLIAVKLWALAHLLAN
GMLHDLLLFGSFLAWAVADRISMKRRTQRAITTLPATKANDVIAIVGGLAVYVVMVVWAH
QWLFGVSPA