Protein Info for Psest_0028 in Pseudomonas stutzeri RCH2

Annotation: Coproporphyrinogen III oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 96% identical to HEM6_PSEU5: Oxygen-dependent coproporphyrinogen-III oxidase (hemF) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00228, coproporphyrinogen III oxidase [EC: 1.3.3.3] (inferred from 96% identity to psa:PST_0026)

MetaCyc: 71% identical to coproporphyrinogen III oxidase (Escherichia coli K-12 substr. MG1655)
Coproporphyrinogen oxidase. [EC: 1.3.3.3]

Predicted SEED Role

"Coproporphyrinogen III oxidase, aerobic (EC 1.3.3.3)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.3.3.3)

MetaCyc Pathways

superpathway of heme b biosynthesis from glutamate (9/10 steps found)
superpathway of heme b biosynthesis from glycine (6/8 steps found)
heme b biosynthesis I (aerobic) (3/4 steps found)
heme b biosynthesis V (aerobic) (3/4 steps found)
superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)
3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (2/9 steps found)
3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (2/9 steps found)

KEGG Metabolic Maps

Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GF51 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psest_0028 Coproporphyrinogen III oxidase (Pseudomonas stutzeri RCH2)
MNHRTEAVKAYLLDLQDRICAALEAEDGGARFAEDAWTRPGGGGGRTRVIENGALIEKGG
VNFSHVHGDSLPPSASAHRPELAGRGFEALGVSLVIHPHNPYVPTSHANVRFFIAEKEGE
EPVWWFGGGFDLTPYYGAEEDCVHWHRVARNACAPFGAEVYPRYKEWCDRYFHIKHRHEP
RGVGGLFFDDLNQWDFDTSFAFMRAVGDAYLDAYLPIVQRRKATPFGERERQFQLLRRGR
YVEYNLVYDRGTLFGLQSGGRTESILMSLPPQVAWGYDKHPEPGTPEARLTEYFLQDRDW
LAEQP