Protein Info for HP15_2732 in Marinobacter adhaerens HP15

Annotation: drug resistance transporter, Bcr/CflA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 118 (23 residues), see Phobius details amino acids 130 to 153 (24 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 276 to 295 (20 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 364 to 385 (22 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 3 to 381 (379 residues), 233.5 bits, see alignment E=2.7e-73 PF07690: MFS_1" amino acids 15 to 353 (339 residues), 148.1 bits, see alignment E=3.2e-47 PF00083: Sugar_tr" amino acids 42 to 119 (78 residues), 26.5 bits, see alignment E=3.1e-10

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 74% identity to maq:Maqu_3300)

Predicted SEED Role

"Multidrug resistance transporter, Bcr/CflA family" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKM0 at UniProt or InterPro

Protein Sequence (397 amino acids)

>HP15_2732 drug resistance transporter, Bcr/CflA subfamily (Marinobacter adhaerens HP15)
MSHLHLAILLGMTVALGPLALDAYLPAFPDIADGLGVDHGHVGLTLSAYVTTLGLAQLVG
GPLSDRYGRKPVLFGGLLIFMAGAVMVSLADTLSDMVFWRIAQGIGGAFCAVSVPAIVRD
EVSGQDAARLFGLIGLIMFIAPAAAPSLGSLMLALGEWHWIFLMLAGYAAFLVLTLQLAL
FPRLQPRTPTTTPIRSLVTNYLLVLKHKTTMRFIGIQVLCFSTMLLFITHSSFIYQEWYG
LSNSTFALLFAANIAFMAALNLTNRPLLRRFSSVQLVRAQVIAQCLALVALVASVQFQGP
LWLVAGCIIVAIGCQGGIVPNNMANAMEFFPNLSGTAAALLGASQFTIAGAVSTLSSVSG
GQTLLSIAVSMLACSSGAVLLALGAPRAVALAKESGL