Protein Info for Psest_2840 in Pseudomonas stutzeri RCH2

Annotation: uridylate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 47 to 61 (15 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details TIGR02075: UMP kinase" amino acids 12 to 243 (232 residues), 328.5 bits, see alignment E=1.2e-102 PF00696: AA_kinase" amino acids 13 to 222 (210 residues), 113.3 bits, see alignment E=7.8e-37

Best Hits

Swiss-Prot: 99% identical to PYRH_PSEU5: Uridylate kinase (pyrH) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K09903, uridylate kinase [EC: 2.7.4.22] (inferred from 99% identity to psa:PST_1539)

MetaCyc: 68% identical to UMP kinase (Escherichia coli K-12 substr. MG1655)
Cytidylate kinase. [EC: 2.7.4.14, 2.7.4.22]

Predicted SEED Role

"Uridine monophosphate kinase (EC 2.7.4.22)" (EC 2.7.4.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.14

Use Curated BLAST to search for 2.7.4.14 or 2.7.4.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPN8 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Psest_2840 uridylate kinase (Pseudomonas stutzeri RCH2)
MAQQMSARNPRYKRILLKLSGEALMGSEDFGIDPKVLDRMALEVGQLVGIGVEVGLVIGG
GNLFRGAALSAAGMDRVTGDHMGMLATVMNALAMRDALERSNIPALVMSAISMVGVTDHY
DRRKAMRHLKTGEVVIFSAGTGNPFFTTDSAACLRAIEIQADVVLKATKVDGVYTADPFK
DPNAEKFAELTYDEVLDRKLGVMDLTAICLCRDHNMPLRVFNMNKPGALLNIVLGGAEGT
LIEESKE