Protein Info for HP15_2729 in Marinobacter adhaerens HP15

Annotation: short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00106: adh_short" amino acids 4 to 197 (194 residues), 177.6 bits, see alignment E=4.3e-56 PF08659: KR" amino acids 5 to 187 (183 residues), 65.5 bits, see alignment E=1.2e-21 PF01370: Epimerase" amino acids 7 to 173 (167 residues), 21.2 bits, see alignment E=3.5e-08 PF13561: adh_short_C2" amino acids 10 to 203 (194 residues), 124 bits, see alignment E=1.6e-39

Best Hits

Swiss-Prot: 38% identical to DRS7B_BOVIN: Dehydrogenase/reductase SDR family member 7B (DHRS7B) from Bos taurus

KEGG orthology group: None (inferred from 53% identity to dfe:Dfer_2713)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKL7 at UniProt or InterPro

Protein Sequence (265 amino acids)

>HP15_2729 short-chain dehydrogenase/reductase SDR (Marinobacter adhaerens HP15)
MSAKTVWITGASSGIGEALALQFAKNGDRLVLSARREDELERVAERCRAAAGTGTGQVLV
LPLDVTDWDSLPGKVEAVLAQFGTIDLLVNNAGVSQRSLCKDTDMSVYQKLMDVDVMGQI
ALTKAVLPHMLERGSGHLAVTSSVAGKVGAPMRTGYCAAKHAVMGFFDALRAEVEGQGVS
VSTITPGFIRTDISRNALAGDGSAYGKEDEDIAGGMDVTECAEVVFKGLEAKKREIPVGK
GKEMAALWIKRISPEALFRMARARS