Protein Info for HP15_2724 in Marinobacter adhaerens HP15

Annotation: short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 PF00106: adh_short" amino acids 26 to 219 (194 residues), 164.7 bits, see alignment E=3.8e-52 PF08659: KR" amino acids 27 to 180 (154 residues), 29.7 bits, see alignment E=1.2e-10 PF13561: adh_short_C2" amino acids 32 to 275 (244 residues), 205.3 bits, see alignment E=2.2e-64 PF23441: SDR" amino acids 148 to 276 (129 residues), 41.7 bits, see alignment E=1.9e-14

Best Hits

KEGG orthology group: None (inferred from 72% identity to mme:Marme_2411)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKL2 at UniProt or InterPro

Protein Sequence (286 amino acids)

>HP15_2724 short-chain dehydrogenase/reductase SDR (Marinobacter adhaerens HP15)
MYTEIDDLGRRKEIKLGFRMKRLDGKTALITGAARGIGEAIAIQFAEQGATVIVSDIDDQ
MGQALVDSSKLDMHYLHLDVSDESQWITCAKSIEDQFGGLDILVNNAGITGFLESAGPHD
PEHLDLASWETVHATNLNGVALGCKYGIKLMKSSRSASIVNISSRSGLVGIPGAAAYASS
KAGVRNHTKSVALHCAEKGYPIRCNSIHPGAIMSPMWEAMLGEGEAREAAIAEVEAGVPI
GRMGKPEDVAYAALYLASDESNYVTGIELNIDGGILAGSASAPARR