Protein Info for Psest_0279 in Pseudomonas stutzeri RCH2

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF07021: MetW" amino acids 2 to 194 (193 residues), 311.5 bits, see alignment E=6.2e-97 TIGR02081: methionine biosynthesis protein MetW" amino acids 2 to 194 (193 residues), 298.9 bits, see alignment E=7.1e-94 PF13489: Methyltransf_23" amino acids 10 to 165 (156 residues), 48.1 bits, see alignment E=3.4e-16 PF13847: Methyltransf_31" amino acids 15 to 104 (90 residues), 40.1 bits, see alignment E=9.3e-14 PF13649: Methyltransf_25" amino acids 18 to 102 (85 residues), 42.4 bits, see alignment E=2.9e-14 PF08242: Methyltransf_12" amino acids 19 to 101 (83 residues), 36.7 bits, see alignment E=1.8e-12 PF08241: Methyltransf_11" amino acids 19 to 104 (86 residues), 47.1 bits, see alignment E=9.6e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_3971)

Predicted SEED Role

"Methionine biosynthesis protein MetW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHJ7 at UniProt or InterPro

Protein Sequence (199 amino acids)

>Psest_0279 methionine biosynthesis protein MetW (Pseudomonas stutzeri RCH2)
MRADLDIIQDWIPAGSRVLDLGCGNGELLAWLRDHKQVSGYGLEIDPDNIAACIDKGVNV
IEQNLDLGLGNFASDSFDMVVMTQALQAVHYPDQLMKEMLRVGRQCIITFPNFGHWRCRW
YLASKGRMPVSEFLPYTWYNTPNIHFCTFEDFERLCQESGARVLERLAVDRDHRHGWASR
LWPNLLGEIGIYRVTGPSR