Protein Info for Psest_2830 in Pseudomonas stutzeri RCH2

Annotation: acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 4 to 256 (253 residues), 312.1 bits, see alignment E=1.2e-97 PF00132: Hexapep" amino acids 15 to 48 (34 residues), 34.3 bits, see alignment 1.9e-12 amino acids 105 to 137 (33 residues), 30.2 bits, see alignment 3.8e-11 PF13720: Acetyltransf_11" amino acids 176 to 256 (81 residues), 89.8 bits, see alignment E=1.9e-29

Best Hits

Swiss-Prot: 99% identical to LPXA_PSEU5: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 99% identity to psa:PST_1549)

MetaCyc: 53% identical to acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Escherichia coli K-12 substr. MG1655)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPM7 at UniProt or InterPro

Protein Sequence (258 amino acids)

>Psest_2830  acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Pseudomonas stutzeri RCH2)
MSLIDPRAIIDPAARLADDVQVGPWSIIGADVEIGEGTVVASHVVIKGPTRIGRHNRIYQ
FSSVGEDTPDLKYKGEPTRLVIGDHNVIREGVTIHRGTVQDRSETTIGNHNLIMAYAHIG
HDSVIANHCILVNNTALAGHVHVGDWAILSGYTLVHQFCHIGAHSFSGMGTAIGKDVPAF
VTVFGNPAEARSMNFEGMRRRGFSAEAVHALRNAYKIVYRKGLTVEAALSELAESAAAFP
EVAIFRDSIQASTRGITR