Protein Info for PGA1_c28170 in Phaeobacter inhibens DSM 17395

Annotation: putative basic membrane lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02608: Bmp" amino acids 26 to 305 (280 residues), 162.9 bits, see alignment E=4.7e-52

Best Hits

Swiss-Prot: 57% identical to PBP_BRUA2: Purine-binding protein BAB2_0673 (BAB2_0673) from Brucella abortus (strain 2308)

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 87% identity to sit:TM1040_0493)

Predicted SEED Role

"Nucleoside ABC transporter, periplasmic nucleoside-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQA8 at UniProt or InterPro

Protein Sequence (358 amino acids)

>PGA1_c28170 putative basic membrane lipoprotein (Phaeobacter inhibens DSM 17395)
MKLNKLLTSAAVALGLATGAVAADDKTKVGFVYVGPVGDGGWTYEHDQGRKAVVAEFGDK
VETVYVENVAEGPDAERVMTQMALEGADLIFTTSFGYMDPTINVAKKFPDVKFEHATGYK
RADNVSTYSARFYEGRAVQGHIAGNLTESNIVGYIGSYPIPEVIRGINSAYLHAKKVNPD
VEFKIVWAFTWFDPAKEADAAKVLIEQGADVILQHTDSTAPQAAAQAAGNVYTFGQASDM
AEYGPKPRVSSIIDDWAPYYIARTQAVMDGSWASTDTWHGIGDGMVKIGEITDAVPAAVK
EEALALKASLADGSYHAFTGPIKKQDGSDWLAEGETADDGTLAGMNFFVEGIQGDIPQ