Protein Info for PGA1_c28160 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 137 to 161 (25 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 245 to 265 (21 residues), see Phobius details amino acids 271 to 290 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 12 to 284 (273 residues), 126.2 bits, see alignment E=6.7e-41

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 89% identity to sit:TM1040_0494)

Predicted SEED Role

"Putative deoxyribose-specific ABC transporter, permease protein" in subsystem Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZW2 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PGA1_c28160 ABC transporter, permease protein (Phaeobacter inhibens DSM 17395)
MDLSAINPVLLIASLMVAATPILIAAIGELVVEKSGVLNLGVEGMMITGAIAGFATAVET
GSPLLGFFAAAFAGAALSVLFGFLTQFAKANQVASGLALTLFGLGLSALMGQSYVGVKPP
QMGDIHIPVLSDLPVVGPILFGHDIILYFGIALTAAVWALLKFSRAGLILRAVGENHDAA
HALGYKVIRIRLMAILFGGACAGVGGAYISLIRVPQWTEGMTAGVGWIALALVVFASWKP
WRALLGAYLFGGVTVVQLNLQAAGVAIPVEYLAMSPYVITIVVLVILSADKSSAPAALGR
NFHASR