Protein Info for HP15_2717 in Marinobacter adhaerens HP15

Annotation: enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF00378: ECH_1" amino acids 10 to 224 (215 residues), 109.3 bits, see alignment E=2.1e-35 PF16113: ECH_2" amino acids 22 to 192 (171 residues), 43.4 bits, see alignment E=3.2e-15

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 75% identity to maq:Maqu_2912)

Predicted SEED Role

"Enoyl-CoA hydratase/isomerase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKK5 at UniProt or InterPro

Protein Sequence (232 amino acids)

>HP15_2717 enoyl-CoA hydratase (Marinobacter adhaerens HP15)
MTDLVSYDLKDGVATIAISNGKANALSQEVFEGLNAALDQAEQDKAVVILTGQPGVFSAG
YDLKEMQKGPKEAAALVKTGSTFTRRLAAFPLPIIGACSGHAIAKGAFILLSVDHRIGIE
GPFKLGLNEVAIGMTMHHAGIEIARHRLAPAHFYRSVVNAEIYNPEGAVEAGFLDEVVAQ
DKLVERATELALHFKTLNMRAHRETKVKAKADYLALLDRCIEQDAEHLGLNG