Protein Info for Psest_2824 in Pseudomonas stutzeri RCH2

Annotation: CTP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 2 to 534 (533 residues), 834.9 bits, E=1.3e-255
• PF06418: CTP_synth_N
  • amino acids 3 to 265 (263 residues), 420.1 bits, E=5.3e-130
• PF00117: GATase
  • amino acids 300 to 533 (234 residues), 149 bits, E=2e-47
• PF07722: Peptidase_C26
  • amino acids 361 to 516 (156 residues), 31.5 bits, E=2.3e-11

Best Hits

Swiss-Prot: 97% identical to PYRG_PSEU5: CTP synthase (pyrG) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 97% identity to psa:PST_1555)

MetaCyc: 70% identical to CTP synthetase (Escherichia coli K-12 substr. MG1655)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See L0GPS6 at UniProt or InterPro

Protein Sequence (543 amino acids)

>Psest_2824 CTP synthase (Pseudomonas stutzeri RCH2)
MTRYIFVTGGVVSSLGKGIASASLAAILEARGLKVTMLKLDPYINVDPGTMSPFQHGEVF
VTHDGAETDLDLGHYERFIRTRMTQNNNFTTGRVYEDVLRRERRGDYLGATIQVIPHITD
EIKRRIIKGAGDADVALVEVGGTVGDIESQPFLEAIRQLRVEVGAKRAMLMHLTLVPYIA
TAGETKTKPTQHSVKELRSIGLQPDVLVCRSDRAIDVSSRRKIALFTNVEERAVISLPDA
DTIYKIPGILHAQGLDDYVVERFGLECRGADLSEWDRVVDAKLHPEKEVTIAMVGKYMEL
LDAYKSLIEAMSHAGIQSRTKVNLRYIDSEDIENQGTGLLKDVDAILVPGGFGLRGVEGK
IATVRYARENKIPYLGICLGMQVAVIEFARDVLGWSDANSTEFDKDSAHPVVGLITEWED
ASGAVETRSDNSDLGGTMRLGAQECGLEAGSKVFECYGQERIVERHRHRYEVNNNLLPQL
QAAGLKITGRSGDGALVEVVEAPDHPWFVACQFHPEFTSTPRDGHPLFSGFVKAALEHKA
KKA