Protein Info for HP15_2713 in Marinobacter adhaerens HP15

Annotation: permease, major facilitator superfamily MFS-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 86 (19 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 127 to 146 (20 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 239 to 250 (12 residues), see Phobius details amino acids 263 to 281 (19 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 326 to 344 (19 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details PF07690: MFS_1" amino acids 8 to 224 (217 residues), 72.9 bits, see alignment E=2.4e-24 amino acids 240 to 379 (140 residues), 37.8 bits, see alignment E=1.1e-13 PF06779: MFS_4" amino acids 10 to 184 (175 residues), 124.9 bits, see alignment E=5e-40 amino acids 237 to 367 (131 residues), 72.3 bits, see alignment E=4.9e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKK1 at UniProt or InterPro

Protein Sequence (385 amino acids)

>HP15_2713 permease, major facilitator superfamily MFS-1 (Marinobacter adhaerens HP15)
MLVASVIAVVVMVGIARFSYTPMIPEMVAALGLSKSVVGMLATVNYAGYLTGAVLITRIS
DLGLKVRLYQLGLVVAVVSTVLMGYTTNVWLWFILRFISGLSTSAGMLLGAGLLMSWLIK
NNQKSELGVFFSGIGLGIVLTAVTAELIKDPFTWDQQWVIYGLVALALLIPAWRWMPDYR
ACALPKRGQPLVATSAVDSYVSCNWRTSAPALAMWSRLPFWWLLLNPCPSFRGRAGWSGI
AGLSATPACWLWDVFSRRWGQWLALYLAYTLNSVSILMLIVNTSLASVMVSSVIYGVSFI
GIVSMMLAMVGRAFPENPSRPMSRLTFSYGIAQMMAPAVVGYLADVEGNYTNGLWLTLVV
MALGVLMLHLARRAKEREAEPALSP