Protein Info for Psest_2816 in Pseudomonas stutzeri RCH2

Annotation: S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02818: S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase
  • amino acids 4 to 371 (368 residues), 736.8 bits, E=2.2e-226
• PF08240: ADH_N
  • amino acids 29 to 159 (131 residues), 87.4 bits, E=7.3e-29
• PF00107: ADH_zinc_N
  • amino acids 199 to 330 (132 residues), 93.3 bits, E=1.2e-30

Best Hits

Swiss-Prot: 73% identical to FRMA_PHODP: S-(hydroxymethyl)glutathione dehydrogenase (frmA) from Photobacterium damsela subsp. piscicida

KEGG orthology group: K00121, S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC: 1.1.1.1 1.1.1.284] (inferred from 100% identity to psa:PST_1563)

MetaCyc: 72% identical to S-(hydroxymethyl)glutathione dehydrogenase (Escherichia coli K-12 substr. MG1655)
S-(hydroxymethyl)glutathione dehydrogenase. [EC: 1.1.1.284]

Predicted SEED Role

"S-(hydroxymethyl)glutathione dehydrogenase (EC 1.1.1.284)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 1.1.1.284)

MetaCyc Pathways

• hexitol fermentation to lactate, formate, ethanol and acetate (16/19 steps found)
• heterolactic fermentation (15/18 steps found)
• ethanolamine utilization (5/5 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
• ethanol degradation II (3/3 steps found)
• formaldehyde oxidation II (glutathione-dependent) (3/3 steps found)
• ethanol degradation I (2/2 steps found)
• mixed acid fermentation (12/16 steps found)
• acetylene degradation (anaerobic) (4/5 steps found)
• pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
• acetaldehyde biosynthesis I (1/1 steps found)
• phytol degradation (3/4 steps found)
• L-isoleucine degradation II (2/3 steps found)
• L-leucine degradation III (2/3 steps found)
• L-valine degradation II (2/3 steps found)
• pyruvate fermentation to ethanol I (2/3 steps found)
• pyruvate fermentation to ethanol III (2/3 steps found)
• pyruvate fermentation to ethanol II (1/2 steps found)
• (S)-propane-1,2-diol degradation (3/5 steps found)
• protein S-nitrosylation and denitrosylation (3/5 steps found)
• L-phenylalanine degradation III (2/4 steps found)
• L-tyrosine degradation III (2/4 steps found)
• L-methionine degradation III (1/3 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• superpathway of N-acetylneuraminate degradation (14/22 steps found)
• salidroside biosynthesis (1/4 steps found)
• serotonin degradation (3/7 steps found)
• phenylethanol biosynthesis (1/5 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (6/13 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (8/17 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• L-tryptophan degradation V (side chain pathway) (1/13 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Drug metabolism - cytochrome P450
• Fatty acid metabolism
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Metabolism of xenobiotics by cytochrome P450
• Methane metabolism
• Retinol metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1, 1.1.1.284

Use Curated BLAST to search for 1.1.1.1 or 1.1.1.284

Sequence Analysis Tools

See L0GMT9 at UniProt or InterPro

Protein Sequence (371 amino acids)

>Psest_2816 S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase (Pseudomonas stutzeri RCH2)
MTIKSRAAVAFGPNQPLQIVEVDVAPPKAGEVLIRIVATGVCHTDAYTLSGEDSEGVFPC
ILGHEGGGIVEAVGEGVTSVAVGDHVIPLYTAECRECKFCKSGKTNLCSSVRATQGKGLM
PDGTTRFSYNGEPIYHYMGCSTFSEYTVLPEVSVAKIPKEAPLEKVCLLGCGVTTGIGAV
LNTAKVEEGATVAIFGLGGIGLAAIIGAKMAKASRIIAIDINPGKFAIAEELGATDFVNP
KDHDKPIQEVIVEMTDGGVDYSFECVGNVQLMRAALECCHKGWGESTIIGVAGAGQEIST
RPFQLVTGRVWRGSAFGGVKGRTELPSYVEKAQSGEIPLDTFITHNLPLDKINEAFDLMH
EGKSIRTVIHF