Protein Info for Psest_2815 in Pseudomonas stutzeri RCH2

Annotation: S-formylglutathione hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 TIGR02821: S-formylglutathione hydrolase" amino acids 4 to 279 (276 residues), 426.3 bits, see alignment E=3e-132 PF00756: Esterase" amino acids 23 to 273 (251 residues), 222.9 bits, see alignment E=5.9e-70 PF00326: Peptidase_S9" amino acids 131 to 262 (132 residues), 25 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 65% identical to SFGH2_ECO57: S-formylglutathione hydrolase YeiG (yeiG) from Escherichia coli O157:H7

KEGG orthology group: K01070, S-formylglutathione hydrolase [EC: 3.1.2.12] (inferred from 94% identity to psa:PST_1564)

MetaCyc: 64% identical to S-formylglutathione hydrolase / S-lactoylglutathione hydrolase (Escherichia coli K-12 substr. MG1655)
Hydroxyacylglutathione hydrolase. [EC: 3.1.2.6]; S-formylglutathione hydrolase. [EC: 3.1.2.6, 3.1.2.12]

Predicted SEED Role

"S-formylglutathione hydrolase (EC 3.1.2.12)" in subsystem Glutathione-dependent pathway of formaldehyde detoxification (EC 3.1.2.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.12 or 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPL3 at UniProt or InterPro

Protein Sequence (281 amino acids)

>Psest_2815 S-formylglutathione hydrolase (Pseudomonas stutzeri RCH2)
MTLEIVSSNKSFGGWHKRYRHRSSSLNCDMVFAVFLPPQAEQGEKLPVLYWLSGLTCTDE
NFMQKAGALRMAAELGLIIVAPDTSPRGAGVPDDPDGAWDFGLGAGFYLNATQEPWAQHY
RMYDYVVDELPALVEANFPVSDRRGISGHSMGGHGALICALKNPGRYLSVSAFAPISNPL
NCPWGEKAFSRYLGEERSRWREWDACALIAEAGEKLPLLVDQGDRDDFMEGQLKPQALQA
AAAAAGHPLTLRIQPGYDHSYYFIASFIDDHLRHHAQALKA