Protein Info for PGA1_c27950 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): N-Acetyl-D-glucosamine ABC transport system, permease component 2
Rationale: Specific phenotypes on N-Acetyl-D-Glucosamine. (SEED_correct)
Original annotation: ABC transporter permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 78 to 101 (24 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 187 to 210 (24 residues), see Phobius details amino acids 247 to 266 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 267 (177 residues), 53.1 bits, see alignment E=1.7e-18

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 89% identity to sil:SPO1837)

MetaCyc: 32% identical to ABC-type sulfoquinovose transporter permease subunit (Clostridium sp. MSTE9)
7.5.2.-

Predicted SEED Role

"N-Acetyl-D-glucosamine ABC transport system, permease protein 2" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTQ0 at UniProt or InterPro

Protein Sequence (280 amino acids)

>PGA1_c27950 N-Acetyl-D-glucosamine ABC transport system, permease component 2 (Phaeobacter inhibens DSM 17395)
MMHKSRSNPFNSILAHGALITYTLIALFPVFVILVNSFKTRKAIFRDPLGLPTSDTFSLV
GYQTVLKQGDFFLYFQNSMIVTVVSLALVLLFGAMAAFALAEYRFKGNMLLGLYLALGIM
IPIRIGTVAILELMVDTGLVNTLTALILVYTAQGLPLAVFILSEFMKQVSDDLKNAGRID
GLSEYTIFFRLVLPLVRPAMATVAVFNMIPIWNDLWFPLILAPAEETKTLTLGSQVFIGQ
FVTDWNAVLSALSMAILPVMVLYVIFSRQLIRGITSGAVK