Protein Info for PGA1_c02870 in Phaeobacter inhibens DSM 17395

Annotation: short chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF00106: adh_short" amino acids 3 to 193 (191 residues), 101.6 bits, see alignment E=6.1e-33 PF08659: KR" amino acids 4 to 126 (123 residues), 33.7 bits, see alignment E=5.4e-12 PF13561: adh_short_C2" amino acids 10 to 246 (237 residues), 108.7 bits, see alignment E=5.6e-35

Best Hits

KEGG orthology group: None (inferred from 69% identity to sit:TM1040_2521)

Predicted SEED Role

"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EW36 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_c02870 short chain dehydrogenase (Phaeobacter inhibens DSM 17395)
MRALVTGAGKRLGRAMALELAENGYDVAVHYASSADAAEATAVDIRAMGRVAVTLQADLL
EEEATEALLPAAADALGGLITCLVNNASIFEHDSLETATRSSWDRHMDSNLRAPFILTQQ
LAAQDLPQQVDEQGRALASASVINLIDQRVRKLTPEFMTYTLAKSALWTLTRTSAQALAP
RIRVNGIGPGPTLRGPRQSESQFARQCANTPLQRGADPADIRAALSYLLRAPSVTGQLIC
IDSGQHLSWETPDVVGLE