Protein Info for HP15_274 in Marinobacter adhaerens HP15

Annotation: ammonium/methylammonium permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 18 to 42 (25 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 142 to 161 (20 residues), see Phobius details amino acids 181 to 203 (23 residues), see Phobius details amino acids 221 to 240 (20 residues), see Phobius details amino acids 260 to 279 (20 residues), see Phobius details amino acids 288 to 305 (18 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 341 to 361 (21 residues), see Phobius details amino acids 367 to 392 (26 residues), see Phobius details TIGR03644: probable ammonium transporter, marine subtype" amino acids 13 to 422 (410 residues), 661.7 bits, see alignment E=1.8e-203 PF00909: Ammonium_transp" amino acids 20 to 419 (400 residues), 317.2 bits, see alignment E=7.1e-99

Best Hits

KEGG orthology group: None (inferred from 81% identity to ttu:TERTU_4184)

Predicted SEED Role

"Ammonium transporter" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKZ6 at UniProt or InterPro

Protein Sequence (427 amino acids)

>HP15_274 ammonium/methylammonium permease (Marinobacter adhaerens HP15)
MESNLNHIFELQYALDTFYFLICGALVMWMAAGFAMLEAGLVRAKNTTEILTKNVALFAV
ACTMYLIVGYDIMYDGGIFLSGVTTVAEMDDAAIAGVIAASTEAGFGDMGEYSGASDFFF
QVVFVATAMSIVSGAVAERMKLWAFLGFAVVMCGFIYPMQGSWTWNGDAVFGMYELSYSD
YAGSGIVHMAGAAAALAGVILLGARKGKYGAKGEIRAFPGANLPLATLGTFILWMGWFGF
NGGSTLKLGGIGVANEVANVFLNTNAAAAGGLIAALIVARLMFGKADLTMALNGALAGLV
AITAEPADPSPLLATIIGAIGGTLVVFSIVTMDKLRIDDPVGAISVHGVVGIWGIFAVLL
SDADATFMGQLVGMLTIFIWVFVTSLIVWGILKAVMGIRVSEEEEYEGVDLSECGMEAYP
EFVSGKQ