Protein Info for HP15_2692 in Marinobacter adhaerens HP15

Annotation: phenylacetate degradation probable enoyl-CoA hydratase paaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 TIGR02280: phenylacetate degradation probable enoyl-CoA hydratase PaaB" amino acids 6 to 263 (258 residues), 420.6 bits, see alignment E=1.2e-130 PF00378: ECH_1" amino acids 9 to 262 (254 residues), 238.1 bits, see alignment E=1e-74 PF16113: ECH_2" amino acids 15 to 200 (186 residues), 103.4 bits, see alignment E=1.9e-33

Best Hits

Swiss-Prot: 61% identical to PAAG_ECOLI: 1,2-epoxyphenylacetyl-CoA isomerase (paaG) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 69% identity to pmk:MDS_2862)

MetaCyc: 67% identical to 1,2-epoxyphenylacetyl-CoA isomerase (Pseudomonas sp. Y2)
RXN0-6510 [EC: 5.3.3.18]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 5.3.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKI0 at UniProt or InterPro

Protein Sequence (263 amino acids)

>HP15_2692 phenylacetate degradation probable enoyl-CoA hydratase paaB (Marinobacter adhaerens HP15)
MTQPSILLEIDQGVALLTLNRPDNLNSFNVEMHERMREAISTVRKDESVRVLVITGSGRG
FCAGQDLSDRSVSPDQEMPDLGASLENYYNPLMRSLRDLPMPVLCAVNGVAAGAGANIAL
ACDITLAARSANFVQAFCKLGLVPDSGGTWTLPRVAGMARAKGMALLGDKISAEQAENWG
MIWRCVDNEQLMEETMKLARHFATQPTKGLALIKRALHASASNTFEEQINLERDLQRMAG
QTEDYREGVAAFMEKRTPNFKGK