Protein Info for PGA1_c27900 in Phaeobacter inhibens DSM 17395

Annotation: ligand-binding UTRA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF00392: GntR" amino acids 21 to 83 (63 residues), 52.1 bits, see alignment E=6.2e-18 PF09339: HTH_IclR" amino acids 47 to 76 (30 residues), 22.1 bits, see alignment 1.6e-08 PF07702: UTRA" amino acids 107 to 242 (136 residues), 129.8 bits, see alignment E=9.9e-42

Best Hits

KEGG orthology group: K03710, GntR family transcriptional regulator (inferred from 76% identity to sil:SPO1842)

Predicted SEED Role

"Predicted transcriptional regulator of N-Acetylglucosamine utilization, GntR family" in subsystem Chitin and N-acetylglucosamine utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTP3 at UniProt or InterPro

Protein Sequence (252 amino acids)

>PGA1_c27900 ligand-binding UTRA domain-containing protein (Phaeobacter inhibens DSM 17395)
MTVEEFLTPAAWLDDAAGPRYVRLRQRIEDGIETGLLPKSAPLPAEREIATLTGLSRVTV
RRAMQDLVDRGIVVQRQGSGSFVADGTPKVEQSLSQLTSFTEDMERRGYDTSVEWLERGI
HTPSPEEVMALALTSGEAVARIARLRRANGRPMAIERASLPVDILPNPQAVRGSLYEVLE
QSGSRPVRALQRISAINLPEQEAQMLGVEPGMAGLSIVRTSYLRNRRVVEFTRSIYRGDA
YDFVAELRLGTT