Protein Info for PGA1_c27890 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)
Rationale: Specifically important for utilizing N-Acetyl-D-Glucosamine. Automated validation from mutant phenotype: the predicted function (GLUCOSAMINE-6-P-DEAMIN-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: putative hexosephosphate binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01380: SIS
  • amino acids 44 to 162 (119 residues), 57.7 bits, E=5.7e-20
  • amino acids 205 to 320 (116 residues), 34.8 bits, E=6.5e-13

Best Hits

KEGG orthology group: K01504, glucosamine-6-phosphate isomerase [EC: 3.5.99.6] (inferred from 76% identity to sil:SPO1843)

Predicted SEED Role

"Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6)" in subsystem Chitin and N-acetylglucosamine utilization or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 3.5.99.6)

MetaCyc Pathways

• N-acetylglucosamine degradation II (3/3 steps found)
• N-acetylglucosamine degradation I (2/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• superpathway of N-acetylglucosamine, N-acetylmannosamine and N-acetylneuraminate degradation (2/6 steps found)
• chitin derivatives degradation (3/8 steps found)
• chitin degradation I (archaea) (1/7 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.6

Sequence Analysis Tools

See I7F277 at UniProt or InterPro

Protein Sequence (342 amino acids)

>PGA1_c27890 Glucosamine-6-phosphate deaminase [isomerizing], alternative (EC 3.5.99.6) (Phaeobacter inhibens DSM 17395)
MTDITKMRREIDEIPTAVDRLLSHGRVEIEAVADAARALDPNVMVTVARGSSDHVCTYLK
YASEIMLGVPVASVGPSVASIYKAPLRLKGALSLAVSQSGKSPDIVSMAGSARKDGALSV
ALTNDAASPLAAAADHTLDIHAGPELSVAATKTFVTSAVAGLWLLAQWDRNQAVLAALHA
LPEQLDRACRIDWPEVRDAIGARSSLFTLGRGQALAVSNEAALKFKETCQLHAESYSSAE
VLHGPVSIVEEGFPVLGFAAADAAEGALAGIADQIAAKGAQVFATTDKVTAARRVDHVRT
DHALTDPISLIVSFYAMVEAFAASRGIDPDAPRHLKKVTETV