Protein Info for PGA1_c02860 in Phaeobacter inhibens DSM 17395

Annotation: putative sodium/calcium exchanger protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 109 to 142 (34 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 272 to 290 (19 residues), see Phobius details amino acids 297 to 313 (17 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 4 to 141 (138 residues), 85.1 bits, see alignment E=2.6e-28 amino acids 175 to 311 (137 residues), 122.9 bits, see alignment E=5.7e-40 TIGR00367: K+-dependent Na+/Ca+ exchanger homolog" amino acids 9 to 309 (301 residues), 226.5 bits, see alignment E=2.1e-71

Best Hits

KEGG orthology group: K07301, inner membrane protein (inferred from 82% identity to sit:TM1040_2522)

Predicted SEED Role

"K+-dependent Na+/Ca+ exchanger related-protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX47 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PGA1_c02860 putative sodium/calcium exchanger protein (Phaeobacter inhibens DSM 17395)
MMPWLLSGLGLVILLLAGDALVRGAVNLSLRLGVPALIVSLTIVAFGTSAPELLIAIRAV
GENADGIALGNVVGSNTANILMVLGIPALMRSLHTSECDTRKNYVFMLIASVLFIALAFC
GTFTIWSGLILLAALSVVLGVAFREARAHRRNGKDSELDDIEEADPDMPYWRIGIYLFLG
LIGLPLGADLLVDNASIIARTYGVTETVIGLTLVAIGTSLPELATTVMAALRRQADVALG
NVIGSNMFNLLAIVGIATFIGPISVDPSFLRVDLWVMLASSLLLVPFVFFKMDITRTWGI
ILSAVYVVYLVQLF