Protein Info for HP15_2681 in Marinobacter adhaerens HP15

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF07286: D-Glu_cyclase" amino acids 120 to 261 (142 residues), 213.5 bits, see alignment E=5.5e-68

Best Hits

Swiss-Prot: 62% identical to Y1458_ALIFM: Putative hydro-lyase VFMJ11_1458 (VFMJ11_1458) from Aliivibrio fischeri (strain MJ11)

KEGG orthology group: None (inferred from 64% identity to mpc:Mar181_0224)

Predicted SEED Role

"hypothetical protein possibly connected to lactam utilization and allophanate hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKG9 at UniProt or InterPro

Protein Sequence (271 amino acids)

>HP15_2681 hypothetical protein (Marinobacter adhaerens HP15)
MHTGAYSDFKNNLLDQASELRARIRSGAHTAPTSGLANSLLQGNVVILPSEWAGDFLLYC
QNNPVSCPLIGMSQPGDPTLPDLGHDLDIRTDVPEYQVFRNGERAETATDLKSLWRDDLV
TFVLGCSFSFEDALIRAGLSVRNVDEGRNVSMFRSNIATRPAGPFSGNMVVSMRPFNGAD
AIRAIQITTRLPKAHGAPVHIGDPALIGIQDVNQPDFGDPVTIRPGELPLFWACGVTPQL
ALENARLPFAITHVPGKMLLTERLNEELAVL