Protein Info for PGA1_c27790 in Phaeobacter inhibens DSM 17395

Annotation: quinolinate synthetase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00550: quinolinate synthetase complex, A subunit
  • amino acids 49 to 345 (297 residues), 322.3 bits, E=1.6e-100
• PF02445: NadA
  • amino acids 52 to 342 (291 residues), 383.5 bits, E=3.1e-119

Best Hits

Swiss-Prot: 60% identical to NADA_SINFN: Quinolinate synthase A (nadA) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 81% identity to sit:TM1040_2250)

MetaCyc: 42% identical to quinolinate synthase (Thermotoga maritima)
Quinolinate synthase. [EC: 2.5.1.72]

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

See I7F270 at UniProt or InterPro

Protein Sequence (350 amino acids)

>PGA1_c27790 quinolinate synthetase A (Phaeobacter inhibens DSM 17395)
MFDLQTMRDQLANHYDLAPNPALAEEMSGIYAKMNRVVNPIDWATYAPYVAAILALKKER
NAVILAHNYMTPEIYHGVADVVGDSLQLAMEATKVEADVIVQCGVHFMAETSKILSPDKI
VLIPDMEAGCSLAESITANGIAEMRAKYPGAPVVTYVNTTAEVKAASDICCTSSNAAQIV
AAMESDTVIMTPDQYLAQNIAQQVPQKNVVWWEGSCIVHEQYTAKDLRDFREWNPGTRLI
AHPECPPDVVNEADFSGSTSGIIKYVTDEKPEKAMLITECSMASNIADQLPEVDFVGPCN
MCPYMKKITLEKILWSLHTMSEPVEVDPKVAEQARVAVQRMIDLSQKLGI