Protein Info for PGA1_c02850 in Phaeobacter inhibens DSM 17395

Annotation: peptidase S49-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 transmembrane" amino acids 82 to 100 (19 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details PF01343: Peptidase_S49" amino acids 81 to 215 (135 residues), 102.4 bits, see alignment E=1.2e-33

Best Hits

KEGG orthology group: K04774, serine protease SohB [EC: 3.4.21.-] (inferred from 78% identity to sil:SPO3640)

Predicted SEED Role

"Peptidase, family S49"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EIQ5 at UniProt or InterPro

Protein Sequence (265 amino acids)

>PGA1_c02850 peptidase S49-like protein (Phaeobacter inhibens DSM 17395)
MNLKLPFLNKPPLVAVVRLNGAIGMAGRGALNDAALGPVLERAFRKGKPAAVAFEINSPG
GSPVQSALIGARIRRLSEELKVPTIAFVEDVAASGGYWLAASADEIWADESSILGSIGVI
SAGFGAHVFLARQGVERRVYTAGRSKSMLDPFRPENAEDVKRLKQLLGDIHDNFIAHVKD
RRGDKLDTSKDLYTGEIWLGRRAVSLGLIDGIGHLRPKMQARFGPKVRFRRYGIKKPLLG
RIGVQIAQDALSGIEERAEYARFGL