Protein Info for Psest_2774 in Pseudomonas stutzeri RCH2

Annotation: Transcriptional regulators of sugar metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 PF08220: HTH_DeoR" amino acids 6 to 61 (56 residues), 73.5 bits, see alignment E=1.4e-24 PF08279: HTH_11" amino acids 6 to 47 (42 residues), 37.2 bits, see alignment 3.3e-13 PF00455: DeoRC" amino acids 75 to 231 (157 residues), 175.6 bits, see alignment E=1.2e-55

Best Hits

Swiss-Prot: 74% identical to GLPR_PSEAE: Glycerol-3-phosphate regulon repressor (glpR) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02444, DeoR family transcriptional regulator, glycerol-3-phosphate regulon repressor (inferred from 97% identity to psa:PST_1602)

Predicted SEED Role

"Glycerol-3-phosphate regulon repressor, DeoR family" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPH5 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Psest_2774 Transcriptional regulators of sugar metabolism (Pseudomonas stutzeri RCH2)
MSLAPRQQNILELVRERGYVSIDELARHFAVTPQTIRRDINQLGDAGLLRRYHGGAAYDS
SVQNTAYSQRAHQMRDEKQRIAAAMAARIPDQASLFINIGTTTEAIARALLNHRDLKIIT
NDLHVASILSTKEDFDVLIAGGNVRSDGGVVGQATADFISQFKVDFALIGISGIDEDGTL
LDFDYQEVRVSQAIIHNARKVFLAADSSKFGRSAMTRLGSLEQIDCLFTDSAPSEVFAEL
LARHKVQLEIAE