Protein Info for PGA1_c02840 in Phaeobacter inhibens DSM 17395

Annotation: inner membrane transport permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 80 to 81 (2 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details PF01061: ABC2_membrane" amino acids 6 to 216 (211 residues), 104.7 bits, see alignment E=5.2e-34 PF12698: ABC2_membrane_3" amino acids 55 to 243 (189 residues), 43.1 bits, see alignment E=3.1e-15

Best Hits

Swiss-Prot: 41% identical to YADH_SHIFL: Inner membrane transport permease YadH (yadH) from Shigella flexneri

KEGG orthology group: K09686, antibiotic transport system permease protein (inferred from 88% identity to sit:TM1040_2524)

Predicted SEED Role

"ABC-type multidrug transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETL0 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PGA1_c02840 inner membrane transport permease (Phaeobacter inhibens DSM 17395)
MNWTAIASIYRFEMARFFRTLMQSFLSPVLSTSLYFVVFGAAIGSRIDEVEGVPYGAFIV
PGLIMLSVMTQATSNASFGIYFPKFIGTIYELLSAPVNFLEIVIGYVGAAATKALFIGVV
ILVTASLFVDLTIAHPLAMVLFMVLTCVSFALLGFIIGVWAKNFEQLQLVPLLIVTPLVF
LGGSFYSISMLPPIWQKITLFNPVVYLISGFRWSFFGASDVPVGLSLLAIGGFTALCLAV
IWWIFKTGWRIRS