Protein Info for Psest_2773 in Pseudomonas stutzeri RCH2

Annotation: glycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 TIGR01311: glycerol kinase" amino acids 7 to 499 (493 residues), 735.5 bits, see alignment E=1.1e-225 PF00370: FGGY_N" amino acids 9 to 255 (247 residues), 291.7 bits, see alignment E=5e-91 PF02782: FGGY_C" amino acids 265 to 453 (189 residues), 162.9 bits, see alignment E=9.1e-52

Best Hits

Swiss-Prot: 81% identical to GLPK_AZOVD: Glycerol kinase (glpK) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K00864, glycerol kinase [EC: 2.7.1.30] (inferred from 99% identity to psa:PST_1603)

MetaCyc: 74% identical to glycerol kinase (Escherichia coli K-12 substr. MG1655)
Glycerol kinase. [EC: 2.7.1.30]

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPN5 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Psest_2773 glycerol kinase (Pseudomonas stutzeri RCH2)
MSDQNKQFIVALDQGTTSSRAIVLDRNANVVTIAQREFAQIYPQPSWVEHDPMEIWATQS
GVFVEALAQAGITNEQVAAIGITNQRETAIVWDKITGRPIYNAIVWQSRQSTPICDQLKR
DGMEEHIRKTTGLVIDPYFSGTKIKWILDHVEGSRERARRGELLFGTVDCWLIWKMTQGK
AHVTDYTNASRTLLFDIHKLDWDPVMLEALDIPREMLPEVRSSSEIYGHAYIGSGQSTGI
PIAGIAGDQQAALFGQMCVELGQAKNTYGTGCFLLMNTGTKAVQSEHGLLTTIACGPRGE
VNYALEGAIFNGGSTVQWLRDELKVLNESLDSEYFATKVPDSNGIYLVPAFTGLGAPYWD
PRARGALFGLTRGVKVDHLIRAALESIAYQTRDVLDAMQQDAGERLRALRVDGGAVANNF
LMQFQADLLGTQVERPQMKETTALGAAYLAGLATGFWSDLDELRSKSSIERVFEPACGSE
QREALYRGWQKAVDRTRNWAED