Protein Info for Psest_2772 in Pseudomonas stutzeri RCH2

Annotation: MIP family channel proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 46 to 80 (35 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 180 to 203 (24 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details PF00230: MIP" amino acids 10 to 252 (243 residues), 206.1 bits, see alignment E=3.2e-65 TIGR00861: MIP family channel proteins" amino acids 15 to 253 (239 residues), 226.1 bits, see alignment E=2.4e-71

Best Hits

Swiss-Prot: 78% identical to GLPF_PSEAE: Glycerol uptake facilitator protein (glpF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02440, glycerol uptake facilitator protein (inferred from 98% identity to psa:PST_1604)

MetaCyc: 74% identical to glycerol facilitator (Escherichia coli K-12 substr. MG1655)
RXN0-7189; RXN0-7191; TRANS-RXN-131; TRANS-RXN0-460; TRANS-RXN0-536; TRANS-RXN0-537; TRANS-RXN0-551

Predicted SEED Role

"Glycerol uptake facilitator protein" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerol fermenation to 1,3-propanediol

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKJ6 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Psest_2772 MIP family channel proteins (Pseudomonas stutzeri RCH2)
MSTPIVPTLKGQCIAEFLGTALLIFFGTGCVAALKLGGAELGLWEISIIWGIGVSMAVYL
AAGVSGAHLNPAVTIALWLFGTFERHRVPAYILAQVAGAFCSAALVYGLYSSLFFDFEQA
QQMVRGSVESLELASIFSTYPHASLSFGQAFLVEMVITAILLAMIMAITDDGNGLPSGPL
APLLIGLLIAVIGGAMGPLTGFAMNPARDFGPKLMTFFAGWGDVAFTGGKDIPYFLVPIF
APILGACLGAAGYKALICRHLPGVGSAACDAPKPKEKASAEVGSAQPDISKVR