Protein Info for Psest_0272 in Pseudomonas stutzeri RCH2

Annotation: arginine deiminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01078: arginine deiminase
  • amino acids 9 to 415 (407 residues), 545.7 bits, E=3e-168
• PF02274: ADI
  • amino acids 37 to 412 (376 residues), 470.5 bits, E=4.2e-145

Best Hits

Swiss-Prot: 80% identical to ARCA_PSEAE: Arginine deiminase (arcA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01478, arginine deiminase [EC: 3.5.3.6] (inferred from 91% identity to psa:PST_3978)

Predicted SEED Role

"Arginine deiminase (EC 3.5.3.6)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 3.5.3.6)

MetaCyc Pathways

• L-arginine degradation XIII (reductive Stickland reaction) (5/5 steps found)
• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-arginine degradation XIV (oxidative Stickland reaction) (2/6 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.6

Sequence Analysis Tools

See L0GDQ7 at UniProt or InterPro

Protein Sequence (417 amino acids)

>Psest_0272 arginine deiminase (Pseudomonas stutzeri RCH2)
MLQSPKLGVHSEAGKLRKVMVCSPGLAHQRLTPSNCDELLFDDVLWVSQAKRDHFDFVSK
MRERGVEVLEMHNLLTETLSDPEALKWLLDRKITANQVGLGLQGEVRSWLEGLERRQLAE
FLIGGVSGSDLPGSEGGEIVRMFRDYLGHSSFILPPLPNTLFTRDTTCWIYGGVSLNPMH
WTARRQETLLTAAIYRFHPQFRDQDFKVWYGDPELDHGLATLEGGDVMPIGKGVVLIGMG
ERSSRQAIGQLAQSLFRHGAAERVIVAGLPRSRSAMHLDTVFSFCDRDLVTIFPEVVHGI
TAFSLRPDERKPDGIDLRREQAPFLDVVAEALGLTALRVVETGGDSYEVEREQWDDGNNV
VALEPGVVIGYDRNTFTNTMLRKAGVEVITISASELGRGRGGGHCMTCPIIRDAIDY