Protein Info for Psest_2759 in Pseudomonas stutzeri RCH2

Annotation: Co/Zn/Cd efflux system component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details PF01545: Cation_efflux" amino acids 23 to 201 (179 residues), 58.7 bits, see alignment E=3.6e-20

Best Hits

KEGG orthology group: None (inferred from 87% identity to psa:PST_1619)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPF7 at UniProt or InterPro

Protein Sequence (215 amino acids)

>Psest_2759 Co/Zn/Cd efflux system component (Pseudomonas stutzeri RCH2)
MAGNCCSSGCASTAARGRYRRILWIALLINLAMFGVEIGAGLRSGSVSLLADSLDFFGDA
ANYGVSLFVLGLGVTMRARASLAKALTMGLFGIFILVVAIGNFVEGSVPHASTMGVVGVI
ALLANIAVAAMLYAYREGDSNMRSVWLCSRNDALGNLAVMLAALGVFGTGAGWPDLIVAT
IMALLSISAAVQITRHALEELRSERIAVSDVERRA