Protein Info for HP15_2642 in Marinobacter adhaerens HP15

Annotation: protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 TIGR00080: protein-L-isoaspartate O-methyltransferase" amino acids 13 to 215 (203 residues), 213.2 bits, see alignment E=1.9e-67 PF01135: PCMT" amino acids 18 to 214 (197 residues), 208.9 bits, see alignment E=1.6e-65 PF13847: Methyltransf_31" amino acids 80 to 157 (78 residues), 28.1 bits, see alignment E=3.3e-10 PF13649: Methyltransf_25" amino acids 85 to 160 (76 residues), 30.8 bits, see alignment E=7.6e-11

Best Hits

Swiss-Prot: 63% identical to PIMT1_RHOP2: Protein-L-isoaspartate O-methyltransferase 1 (pcm1) from Rhodopseudomonas palustris (strain HaA2)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 63% identity to rpb:RPB_0447)

MetaCyc: 51% identical to protein-L-isoaspartate O-methyltransferase (Escherichia coli K-12 substr. MG1655)
Protein-L-isoaspartate(D-aspartate) O-methyltransferase. [EC: 2.1.1.77]

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJP2 at UniProt or InterPro

Protein Sequence (218 amino acids)

>HP15_2642 protein-L-isoaspartate O-methyltransferase (Marinobacter adhaerens HP15)
MNQDNGFELQRASMVDYQLRARGIGSPLVLEAMGRVPRERFIPERMKDCAYDDGPLPIGA
GQTISQPYIVALMTEALDLEGGERVLDIGTGSGYAAAVLSCIASEVFSIERVQELADRAA
RTLAAEGFDNVRVRCGDGTTGWPEHQPFDGIIVAAGAPAVPDSLKHQLAVGGHLVIPVGS
EHSVQSLERITRLTENEFRTEDLGAVRFVPLIGEQGWS