Protein Info for Psest_0270 in Pseudomonas stutzeri RCH2
Annotation: carbamate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 77% identical to ARCC_PSEAE: Carbamate kinase (arcC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: K00926, carbamate kinase [EC: 2.7.2.2] (inferred from 89% identity to psa:PST_3980)MetaCyc: 44% identical to carbamate kinase (Halobacterium salinarum)
Carbamate kinase. [EC: 2.7.2.2, 6.3.4.16, 6.3.5.5]
Predicted SEED Role
"Carbamate kinase (EC 2.7.2.2)" in subsystem Arginine Deiminase Pathway or Arginine and Ornithine Degradation or MLST or Polyamine Metabolism (EC 2.7.2.2)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
- L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
- superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
- superpathway of arginine and polyamine biosynthesis (14/17 steps found)
- UMP biosynthesis I (6/6 steps found)
- UMP biosynthesis II (6/6 steps found)
- L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
- L-citrulline biosynthesis (7/8 steps found)
- L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
- L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
- glutaminyl-tRNAgln biosynthesis via transamidation (4/4 steps found)
- L-citrulline degradation (3/3 steps found)
- ammonia assimilation cycle III (3/3 steps found)
- UMP biosynthesis III (5/6 steps found)
- L-glutamate biosynthesis I (2/2 steps found)
- superpathway of L-citrulline metabolism (9/12 steps found)
- L-glutamine degradation I (1/1 steps found)
- L-glutamate and L-glutamine biosynthesis (5/7 steps found)
- urea cycle (3/5 steps found)
- L-arginine biosynthesis IV (archaea) (4/9 steps found)
- allantoin degradation IV (anaerobic) (2/9 steps found)
- guadinomine B biosynthesis (2/13 steps found)
KEGG Metabolic Maps
- Arginine and proline metabolism
- Glutamate metabolism
- Nitrogen metabolism
- Purine metabolism
- Pyrimidine metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 6.3.5.5
Use Curated BLAST to search for 2.7.2.2 or 6.3.4.16 or 6.3.5.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See L0GFU3 at UniProt or InterPro
Protein Sequence (307 amino acids)
>Psest_0270 carbamate kinase (Pseudomonas stutzeri RCH2) MRIVIALGGNALLRRGEPLSADNQRENVRTACMQIARIAAGNELVVAHGNGPQVGLLALQ GAAYKDVPVYPLDVLGAETEGMIGYIIEQELGNLLPFEVPMATLLTQVEVDPEDPAFKQP SKPIGPVYSREEAERLAEEKGWAIAADGDRFRRVVPSPRPKRIFEIRPIGWLLDKGSVVI CAGGGGIPTVYDQSGRLQGVEAVIDKDLCSALLAEQLKADLLVIATDVDGAYLDWGTPQQ RRISEAHPDQLQSRGFAAGSMGPKVQAACEFARNTGNVAVIGSLEQIEAIIKGQAGTRVS LEAAGLV