Protein Info for Psest_2743 in Pseudomonas stutzeri RCH2

Annotation: Methylase involved in ubiquinone/menaquinone biosynthesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF13489: Methyltransf_23" amino acids 28 to 146 (119 residues), 28.4 bits, see alignment E=2.6e-10 PF13649: Methyltransf_25" amino acids 45 to 135 (91 residues), 43.2 bits, see alignment E=1e-14 PF08242: Methyltransf_12" amino acids 45 to 137 (93 residues), 37.7 bits, see alignment E=5.6e-13 PF08241: Methyltransf_11" amino acids 45 to 139 (95 residues), 34 bits, see alignment E=7.5e-12

Best Hits

KEGG orthology group: None (inferred from 80% identity to avn:Avin_33370)

Predicted SEED Role

"SAM-dependent methyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPK5 at UniProt or InterPro

Protein Sequence (247 amino acids)

>Psest_2743 Methylase involved in ubiquinone/menaquinone biosynthesis (Pseudomonas stutzeri RCH2)
MPGDALYTDLSGYYDLMCADIDYGAQSHCVQRLQQLFGNGGTRHLDLACGTGPHVRHFID
AGYTSGGLDINQPMLDRAAVRCPEAQFSLQDMCGFAVEQPADLITCFLYSIHYSGGVERL
KACIASVHAALAPGGLFCFNAVDKRRIDNASFVSHTARHADGLFTFSSGWHYPGEGEQQL
LRLRIEKSVADQSQVWHDEHAMVAVSFAELSELLESYFEVHVLEHDYEKIVPWNEVSGNA
LFVCIKR