Protein Info for PGA1_c27290 in Phaeobacter inhibens DSM 17395

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 PF00072: Response_reg" amino acids 10 to 128 (119 residues), 63.2 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 33% identical to FILR2_METH6: Probable methanogenesis regulatory protein FilR2 (filR2) from Methanosaeta harundinacea (strain 6Ac)

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 60% identity to rde:RD1_1491)

Predicted SEED Role

"response regulator, putative( EC:2.7.3.- )"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTI7 at UniProt or InterPro

Protein Sequence (143 amino acids)

>PGA1_c27290 response regulator (Phaeobacter inhibens DSM 17395)
MTNRESVTFLIVDDDEVAVMAIKRALKKLRLVNPIEVVGDGQEALDLLRGVNSAALERPY
IILLDLNMPRMGGLEFLAEVREDKELANSVIFVLTTSDAPSDIAVAYEHKIAGYIVKENA
YDAVKSAVEMLGAYVEIVSLKTN