Protein Info for PGA1_c27160 in Phaeobacter inhibens DSM 17395

Annotation: TRAP transporter, subunit DctM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 5 to 20 (16 residues), see Phobius details amino acids 22 to 22 (1 residues), see Phobius details amino acids 41 to 42 (2 residues), see Phobius details transmembrane" amino acids 21 to 21 (1 residues), see Phobius details amino acids 23 to 40 (18 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 115 to 132 (18 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 251 to 271 (21 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 326 (19 residues), see Phobius details amino acids 341 to 362 (22 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details amino acids 407 to 431 (25 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details amino acids 465 to 492 (28 residues), see Phobius details PF06808: DctM" amino acids 12 to 489 (478 residues), 198.3 bits, see alignment E=1e-62

Best Hits

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EQ38 at UniProt or InterPro

Protein Sequence (500 amino acids)

>PGA1_c27160 TRAP transporter, subunit DctM (Phaeobacter inhibens DSM 17395)
MSYELIAIMMFAGMMLMLMTGQRVFGAIGFVGALAGMLLWGTGGSEIPFSAAMKLMKWYP
LLTLPMFIFMGYVLSESKIADDLYRMFHVWMGPVKGGLAIGTIGLMVLISAMNGLSVAGM
AIGATIALPELLRRGYDKTLVTGTIQAGSSLGILVPPSVVLVLYAMIARQPVGQLWLAGV
VPGLLMATMFIIYIYLRARMQPELGPAMSPEDLAEYERISDHPLRLNYVALALLVLVPLV
VKLGVIEAKPAIGVALAGSVLAFVTRGIPAFYHDVFMREKYRLLFSGVLPLAIFAAMMVP
FVNGWTSLVESSAIGAMTAFIAAILKGRMNKEVFETSVRSTLGISCMFMWIILAALGFGA
IFDGLGAVKAIEDLFTTQLGLSPWMILILMQLSFIVMGTFLDDTAMLVIVAPLYVPLVGA
LGFDLIWYGVLYTITTQIAYMTPPFGYNLFLMRAMAPPEIGLKDIYVSIIPFAAVMVVAL
ALVMIFPQIALWLPEYVYGK