Protein Info for HP15_2616 in Marinobacter adhaerens HP15

Annotation: protein containing DUF482

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF04339: FemAB_like" amino acids 36 to 404 (369 residues), 498.5 bits, see alignment E=1.3e-153 PF13480: Acetyltransf_6" amino acids 216 to 351 (136 residues), 39.9 bits, see alignment E=4.7e-14

Best Hits

KEGG orthology group: K09919, hypothetical protein (inferred from 77% identity to maq:Maqu_2871)

Predicted SEED Role

"COGs COG3146"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJL6 at UniProt or InterPro

Protein Sequence (408 amino acids)

>HP15_2616 protein containing DUF482 (Marinobacter adhaerens HP15)
MIKSRLLTYGIGYIKEFSLTMSEPGPATLTLETCTSINDIPAPEWERLAGHSNPFLRYEF
FQALEASGCTSPETGWSPRHLVFRKAGRIVGLAPAFLKSHSMGEYVFDWAWADAYQRHGL
AYYPKLLIAIPFTPSSGPRLLLDPDIRQQLVPEQVHHLLDRLTDELGAHSWHLLFPGKED
QELLQHEQALHRIGCQFHWHNHDYRNFEDFLAALTSRKRKSIRKERRQVADQGISFTRFH
GRDIPEHVLSAFYVFYQATYLKRGQRPYLNKRFFELLQEQLPEHVHLVMAVREGEMIAGA
LFLAGTTTLYGRYWGCLDEYNHLHFETCYYQGIELAMDLGLSHIDAGAQGEHKLVRGFEP
VITHSWHGVLHPGFREAIENFTREEADHVRAYFSDAEAALPFRQQTPD