Protein Info for HP15_266 in Marinobacter adhaerens HP15

Annotation: UBA/THIF-type NAD/FAD binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 249 to 268 (20 residues), see Phobius details PF00899: ThiF" amino acids 30 to 271 (242 residues), 135.1 bits, see alignment E=2.4e-43 PF02737: 3HCDH_N" amino acids 43 to 134 (92 residues), 23.5 bits, see alignment E=4.6e-09

Best Hits

Swiss-Prot: 58% identical to TCDA_ECOLI: tRNA threonylcarbamoyladenosine dehydratase (tcdA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 90% identity to maq:Maqu_0512)

MetaCyc: 58% identical to tRNA threonylcarbamoyladenosine dehydratase (Escherichia coli K-12 substr. MG1655)
RXN0-7115

Predicted SEED Role

"CsdL (EC-YgdL) protein of the HesA/MoeB/ThiF family, part of the CsdA-E-L sulfur transfer pathway"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PKY8 at UniProt or InterPro

Protein Sequence (277 amino acids)

>HP15_266 UBA/THIF-type NAD/FAD binding protein (Marinobacter adhaerens HP15)
MILSGLRPDLHGDTMNADDYAFRFGGIERLYGRRALEAFRHANIAVVGLGGVGSWAAEAL
ARSGVGTITLIDMDDVCVSNTNRQLHALEGQYGRTKTDAMADRLRAINPEADIRVHFGFL
TTKNVSELITEDMTGVIDAIDSVKAKAALIAHCQRRKIPLVCAGGAGGQIDPTQIQVADL
SKTTQDPLLAKVRNLLRREYGFSRNPKRRFGIEAVYSLEQLTYPAGDGEVCLQKPATDGP
VRLDCASGFGAASPVTASFGLFAASRLLNRIARRANQ