Protein Info for HP15_2610 in Marinobacter adhaerens HP15

Annotation: D-amino acid dehydrogenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 264 to 282 (19 residues), see Phobius details PF01266: DAO" amino acids 13 to 411 (399 residues), 231 bits, see alignment E=1.3e-71 PF00890: FAD_binding_2" amino acids 13 to 276 (264 residues), 28.2 bits, see alignment E=4.6e-10 PF02558: ApbA" amino acids 13 to 68 (56 residues), 30.8 bits, see alignment 8.4e-11 PF13450: NAD_binding_8" amino acids 15 to 52 (38 residues), 32.2 bits, see alignment 4.2e-11

Best Hits

Swiss-Prot: 55% identical to DADA_DECAR: D-amino acid dehydrogenase (dadA) from Dechloromonas aromatica (strain RCB)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 84% identity to maq:Maqu_2864)

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJL0 at UniProt or InterPro

Protein Sequence (427 amino acids)

>HP15_2610 D-amino acid dehydrogenase small subunit (Marinobacter adhaerens HP15)
MADSVRPEASMHILVLGAGVVGTTTAWYLQKQGHQVTVVDRQNQAGLETSYANGGQISVS
HAEPWANPSAPLKVMKWLFQPDAPLLFRPRLDPAQWRWALSFLGQCTLARAAHNIRQMVN
LGTYSCSQLQALREEAGIEYNHLEKGILHFYTNPAEFDGAMEPTRIMQDLGCDRQIIDAD
RAVELEPALKPIRNRIAGATYTSEDESGDARMFTQNLAKRCAEAGVEFRYGTEILSFERA
GERVLGIQTLRDGHHETLRADAYVLSMGSFSAALASQLGIFLNIYPAKGYSITVPVKNEE
AAFNVSLTDDEYKLVYSRLGDRMRVAGTAELNGYSRKLNYTRCRAIVRRTAEVMPEAGYW
DQAEFWTGLRPATPSNVPYIGKSHFANLYLNTGHGTLGWTHSCGSAAALADIIDGRKPEV
DFTFSGL