Protein Info for Psest_2717 in Pseudomonas stutzeri RCH2

Annotation: Succinylglutamate desuccinylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 332 PF24827: AstE_AspA_cat" amino acids 49 to 235 (187 residues), 138.6 bits, see alignment E=1.9e-44 PF04952: AstE_AspA_hybrid" amino acids 256 to 324 (69 residues), 58.4 bits, see alignment E=5.8e-20

Best Hits

Swiss-Prot: 54% identical to ASTE_PSEA7: Succinylglutamate desuccinylase (astE) from Pseudomonas aeruginosa (strain PA7)

KEGG orthology group: K05526, succinylglutamate desuccinylase [EC: 3.5.1.96] (inferred from 78% identity to psa:PST_1651)

Predicted SEED Role

"Succinylglutamate desuccinylase (EC 3.5.1.96)" in subsystem Arginine and Ornithine Degradation (EC 3.5.1.96)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.96

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GPB9 at UniProt or InterPro

Protein Sequence (332 amino acids)

>Psest_2717 Succinylglutamate desuccinylase (Pseudomonas stutzeri RCH2)
MLALGKLLELTLAGREPCEKVQLTPRGVKLHWLADGALLVSPPPGQDQGLDLLLSAGIHG
NELIPIHVLDRLVRALARDDVRPRAPLLLLFANPAAMRRMVRQVEHDLNRLFRGEHADVW
GGEAIRAAELEALVGGFFSGAGRQRRHYDLHSALRPSRLAQFAICPWRECEQVSAESLTR
LDRLAIEGVLLQRQATSTFSAMTSTRYGAEAFTLELAEGAGESLPVAVVQFERGLYGMIE
GREAPVAAHALPQLLQISREVIKRSPRFRLCVPSDIENFAPLPLGSVLAEDDGARWVIDE
PGARILFPMADVAEGQRAALIVVPLEQTEGER