Protein Info for PGA1_c26930 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 146 to 168 (23 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 223 to 244 (22 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 274 to 296 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 17 to 291 (275 residues), 104.9 bits, see alignment E=2.2e-34

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 84% identity to dsh:Dshi_1945)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZL1 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PGA1_c26930 ABC transporter, permease protein (Phaeobacter inhibens DSM 17395)
MDILDILLSASFWAAAIRIASPLIFATLGELICERVGVLNLGIEGIMVAGAFSGWIAVWA
GLPLWGGVGVALLTGMAFGLLHATLSVPFGLSQHVVGIGLTLLATSLTFYTYRVVLPEVS
SPPKIEAFQPYEIPLLSDLPLIGPALFSQTPLTYAAFVLAALCAYTLYRTPLGLAVRAAG
ENPSAVAAQGLSVTAIRMGAVVVGSGIMAVGGAFLTLSAFDSFFFDMVNGRGWICIALVV
FGAWRPGKAVLGAILFAAFDALQIRLQQTGIGAVVPYQLFLMLPYILSILALILMSRRAE
VPAALMVPFNKGER