Protein Info for Psest_2705 in Pseudomonas stutzeri RCH2

Annotation: Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 208 PF00072: Response_reg" amino acids 4 to 115 (112 residues), 85.9 bits, see alignment E=2.3e-28 PF00196: GerE" amino acids 147 to 202 (56 residues), 67.7 bits, see alignment E=5.5e-23

Best Hits

Swiss-Prot: 52% identical to BVGA_BORPE: Virulence factors putative positive transcription regulator BvgA (bvgA) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K07690, two-component system, NarL family, response regulator EvgA (inferred from 55% identity to pfo:Pfl01_3974)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GKE1 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Psest_2705 Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain (Pseudomonas stutzeri RCH2)
MKTVLIVDDHPFICLAVRMLLERDGYSVVGEADNGVDAIQQAKVLQPDLVIVDIGIPKLD
GLSVIMRLRLLNDALKVLVLSSQPAGLFSTRCRQAGAAGYVCKSGDLGELSSAIQAIKSG
YDYFPSLTASSVSHRDASGSEVERLNSLSDREITVLRLLALGHSNKQIGEDLALSNKTIS
CYKTRIMEKLRVRTLVDLAEIAKRNSFT