Protein Info for PGA1_c26920 in Phaeobacter inhibens DSM 17395

Annotation: ABC transporter, permease protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details transmembrane" amino acids 62 to 80 (19 residues), see Phobius details amino acids 91 to 108 (18 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 196 to 214 (19 residues), see Phobius details amino acids 243 to 260 (18 residues), see Phobius details amino acids 280 to 310 (31 residues), see Phobius details amino acids 322 to 342 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 58 to 335 (278 residues), 137.2 bits, see alignment E=3.1e-44

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 77% identity to dsh:Dshi_1946)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DTG2 at UniProt or InterPro

Protein Sequence (349 amino acids)

>PGA1_c26920 ABC transporter, permease protein (Phaeobacter inhibens DSM 17395)
MRLEPIAAPSWQRRLMPPALALLATFALAALLAQIAGGEPLSIFGLILTGAFGSKFALLE
TLNRATPLIFTGLAIAVAFRAKLWNIGAEAQLYAGAVITVVLGTGALNLPAPLLLPLLGA
AALIAGAVLLLGPALLKTRLGVDEVVTTLLFNFIFLLFVSYLLEGPLKDPMGMGWPKSPR
LSADARLPRVVDGLRLHWGFALALISALVIWVINTRTTLGYEMRAVGQNAEAARFAGIPV
TKVILKTALLSGGLAGLAGYSEVSGLKGALTLDLSPGFGYTGIVVAMLALLHPIGVVFAA
LFVAAIFVGADSMSRAAGVPSYLADIMLASALLLMVLAILLSKFRLRRD